PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC26324_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 89aa    MW: 10104.7 Da    PI: 11.3323
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC26324_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.32.2e-401474363
       zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                 e+alkcprCdstntkfCy+nny+l+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk+s+s
  RrC26324_p1 14 EAALKCPRCDSTNTKFCYFNNYNLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRSKS 74
                 6789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-32166IPR003851Zinc finger, Dof-type
PfamPF027011.2E-331571IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4691771IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101955IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MVERARIAKI PLPEAALKCP RCDSTNTKFC YFNNYNLTQP RHFCKTCRRY WTRGGALRNV  60
PVGGGFRRNK RSKSNGGGRS KSTVVLLEP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013677436.14e-57PREDICTED: dof zinc finger protein DOF3.6-like
SwissprotQ9M2U12e-51DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A078JRU02e-57A0A078JRU0_BRANA; BnaCnng62100D protein
TrEMBLA0A0D3BXR73e-57A0A0D3BXR7_BRAOL; Uncharacterized protein
STRINGBra014752.1-P4e-55(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.27e-46OBF-binding protein 3